FOXO4-DRI

£199.99

FOXO4-DRI 10mg PEPtide Vial

There are many research medical studies that show this compound to be a beneficial product for treating hair loss.

 

Buy 5 and get 5% Discount | Buy 10 and get 10% Discount

358 in stock

- +

358 in stock

Description

FOXO4-DRI 10mg PEPtide Vial

This product is intended for research and medical purposes only, to be only used by trained professionals.

DHT is the major cause of hair loss. This molecule is created by dihydrotestosterone, which is naturally produced by the body as a male hormone. In the scalp, DHT travels down the hair follicle shaft and attaches itself to a dikaryon-homologous protein. This protein breaks off into two strands, forming what we know as the hair follicle’s DHT-inhibiting enzyme. DHT functions to slow down hair growth and can be found at a hair follicle’s surface.

The main reason that DHT becomes a problem in the scalp is because of the way it “bumps” of a smaller protein named FHRP, which then attaches itself to the core of hair follicles, the roots. This causes the hair to be lost. When DHT attaches itself to FHRP, it stops hair from growing and starts hair thinning. Research has suggested on mice and rats, with FOXO4-DRI, there is an increase in the blood supply to the scalp. The hair follicles benefit as well, as there is an increased supply of nutrients and growth hormones that make them thrive. As a result, the proteins in the follicles enlarge and the DHT-blocking enzyme functions to reduce hair loss, preventing hair thinning and hair loss.

Unlike some other molecules that have protective activity against DHT, such as melanocortin receptors, FOXO4-DRI is designed to stop DHT. There are many research medical studies that show this compound to be a beneficial product for treating hair loss. This peptide in studies has shown promising results to help with hair loss treatment.


References:

  • https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5556182/

Purity: >98%
Molecular Formula: C228H388N86O64
Molecular Weight: 5358.05 g/mol
Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH


DISCLAIMER: We do not supply peptides to Any individual under the age of 18. You must be a licensed and qualified healthcare practitioner. Our team of dedicated professionals are committed to providing an extensive range of products used in the process of medical research by responsible trained and professional individuals. All products listed on this website (https://direct-peptides.com) and provided through Direct Peptides are intended for medical research purposes only. Direct Peptides does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption), nor are the products intended to be used as a drug, stimulant or for use in any food products.